Crotalus tigris (Tiger rattlesnake): 120301578 Help Entry 120301578         CDS       T08476                                  Name (RefSeq) thioredoxin-like isoform X1   KO K03671   thioredoxin Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig04621   NOD-like receptor signaling pathway ctig05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ctig00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120301578  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120301578  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ctig03110]     120301578 Chaperones and folding catalysts [BR:ctig03110]  Protein folding catalysts   Protein disulfide isomerase    120301578 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_9 Glutaredoxin Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Redoxin Motif Other DBs NCBI-GeneID:  120301578 NCBI-ProteinID:  XP_039184924 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MLPKMHNKKEFAEFLKSAGPRLVVVNFTAKWCGPCKIVRPFLYELAVRYENVLFCIVDVD LAEDVAVLCNIVVVPTFQFFMKGDKIFEVTGPNTKKLEEKIGEFM NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgttgccaaaaatgcacaataagaaagaatttgcggaatttctgaagagcgcaggaccc cgccttgttgtggtgaactttacagcaaaatggtgtgggccttgcaaaattgttcgtcct tttctttatgaattggctgttcgatatgaaaatgtcctattctgtattgttgatgtggac ttagcagaagatgtagcagtcctctgcaatattgtcgttgtgccaacatttcaattcttc atgaaaggagacaagatttttgaagtaactggacctaatacaaaaaagcttgaagagaag attggagaatttatgtaa

DBGET integrated database retrieval system