Crotalus tigris (Tiger rattlesnake): 120303980 Help Entry 120303980         CDS       T08476                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig04081   Hormone signaling ctig04144   Endocytosis ctig04150   mTOR signaling pathway ctig04270   Vascular smooth muscle contraction ctig04310   Wnt signaling pathway ctig04350   TGF-beta signaling pathway ctig04510   Focal adhesion ctig04520   Adherens junction ctig04530   Tight junction ctig04621   NOD-like receptor signaling pathway ctig04625   C-type lectin receptor signaling pathway ctig04810   Regulation of actin cytoskeleton ctig05100   Bacterial invasion of epithelial cells ctig05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ctig00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120303980 (RHOA)    04350 TGF-beta signaling pathway     120303980 (RHOA)    04150 mTOR signaling pathway     120303980 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     120303980 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120303980 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120303980 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctig04131]     120303980 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctig04147]     120303980 (RHOA)    04031 GTP-binding proteins [BR:ctig04031]     120303980 (RHOA) Membrane trafficking [BR:ctig04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120303980 (RHOA) Exosome [BR:ctig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120303980 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    120303980 (RHOA)   Exosomal proteins of colorectal cancer cells    120303980 (RHOA)   Exosomal proteins of bladder cancer cells    120303980 (RHOA) GTP-binding proteins [BR:ctig04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120303980 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120303980 NCBI-ProteinID:  XP_039189929 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcggaaaaaactggttatagttggtgatggtgcctgtggcaagacatgt ctgctgattgtatttagtaaagaccagtttcctgaagtttatgttcctacagtatttgaa aactatgtagcagatattgaagttgatggaaagcaggtggagctggccttatgggataca gctggacaagaagactatgatcgacttaggccactttcatatccagacaccgatgttata ctaatgtgtttttcaattgatagtccagatagtttagaaaacattccagagaagtggact ccagaggtgaaacacttctgccccaatgtacccatcattctggtaggaaataagaaggat ttgaggaacgatgaacacacaagacgggagttggctaaaatgaagcaggaaccagtcaaa cctgaagaaggtagagatatggcaaatcgcattggtgcttttggatacatggaatgcagt gcaaagaccaaagacggtgtgagggaagtttttgaaatggctactagagctgctttacaa gcccgacgtggcaagaaaaaatctgggtgccttctgttgtaa

DBGET integrated database retrieval system