Crotalus tigris (Tiger rattlesnake): 120308932 Help Entry 120308932         CDS       T08476                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig04137   Mitophagy - animal ctig04140   Autophagy - animal ctig04144   Endocytosis ctig04145   Phagosome ctig04148   Efferocytosis ctig05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ctig00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120308932 (RAB7A)    04145 Phagosome     120308932 (RAB7A)    04140 Autophagy - animal     120308932 (RAB7A)    04137 Mitophagy - animal     120308932 (RAB7A)    04148 Efferocytosis     120308932 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120308932 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctig04131]     120308932 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctig04147]     120308932 (RAB7A)    04031 GTP-binding proteins [BR:ctig04031]     120308932 (RAB7A) Membrane trafficking [BR:ctig04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120308932 (RAB7A) Exosome [BR:ctig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120308932 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    120308932 (RAB7A)   Exosomal proteins of colorectal cancer cells    120308932 (RAB7A)   Exosomal proteins of bladder cancer cells    120308932 (RAB7A) GTP-binding proteins [BR:ctig04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120308932 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  120308932 NCBI-ProteinID:  XP_039201581 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctagaaagaaagtattactcaaagtcatcattcttggagattcgggggtggga aagacatctcttatgaatcagtatgttaacaagaaattcagtaaccaatacaaagctaca ataggagcagacttcctgaccaaggaggtgatggtggatgacagattagtcacaatgcag atatgggatacagcagggcaagagcggtttcagtctttgggagttgccttctatagggga gcagactgctgtgtgctggtttttgatgtaacagctcccaacacatttaaaactcttgat agttggcgagacgaatttctcattcaagccagtccacgagatcctgagaactttcctttt gttgtgctggggaacaagattgacttagaaaatagacaagttaccacaaaaagagcacag gcctggtgctacagcaaaaacaatattccttactttgaaaccagtgcgaaggaggccatt aatgtggaacaagctttccaaacaattgcacgaaatgcacttaaacaggaaactgaagtg gagctttacaatgaatttccggaacctatcaagctagacaagaacgaccgggcaaaggct tctgcggagagctgtagctgctga

DBGET integrated database retrieval system