Crotalus tigris (Tiger rattlesnake): 120314134 Help Entry 120314134         CDS       T08476                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig04010   MAPK signaling pathway ctig04012   ErbB signaling pathway ctig04068   FoxO signaling pathway ctig04137   Mitophagy - animal ctig04140   Autophagy - animal ctig04150   mTOR signaling pathway ctig04210   Apoptosis ctig04218   Cellular senescence ctig04370   VEGF signaling pathway ctig04371   Apelin signaling pathway ctig04540   Gap junction ctig04625   C-type lectin receptor signaling pathway ctig04810   Regulation of actin cytoskeleton ctig04910   Insulin signaling pathway ctig04912   GnRH signaling pathway ctig04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ctig00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120314134 (NRAS)    04012 ErbB signaling pathway     120314134 (NRAS)    04370 VEGF signaling pathway     120314134 (NRAS)    04371 Apelin signaling pathway     120314134 (NRAS)    04068 FoxO signaling pathway     120314134 (NRAS)    04150 mTOR signaling pathway     120314134 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120314134 (NRAS)    04137 Mitophagy - animal     120314134 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120314134 (NRAS)    04218 Cellular senescence     120314134 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120314134 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120314134 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120314134 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120314134 (NRAS)    04912 GnRH signaling pathway     120314134 (NRAS)    04916 Melanogenesis     120314134 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctig04131]     120314134 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctig04147]     120314134 (NRAS)    04031 GTP-binding proteins [BR:ctig04031]     120314134 (NRAS) Membrane trafficking [BR:ctig04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120314134 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120314134 (NRAS) Exosome [BR:ctig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120314134 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120314134 (NRAS)   Exosomal proteins of breast cancer cells    120314134 (NRAS)   Exosomal proteins of colorectal cancer cells    120314134 (NRAS) GTP-binding proteins [BR:ctig04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120314134 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  120314134 NCBI-ProteinID:  XP_039212845 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSNEDGNQG CMGVSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaattggtggtagtaggagctgggggtgttggaaaaagtgccctgacc atccagcttatccagaatcactttgtagatgaatatgatcctactattgaggattcttac cgtaaacaagttgttattgatggagagacttgtttgctagacatcctggatacggcagga caggaggaatatagtgccatgagggaccaatatatgagaactggggaaggctttctttgt gtgttcgccattaacaacagcaaatcatttgcagatataaatctttacagagagcaaatt aaaagagtgaaagattcagaagatgtaccaatggtattagtgggaaacaaatgtgattta ccaacacgaacagtagacaccaagcaggctcacgaagtagcaaagagctatggcattcca ttcattgaaacatctgccaaaacaagacagggtgttgaagatgctttttatacattggtt agagaaatccgtcagtatcgaatgaaaaggctcaacagtaatgaagatggaaatcaaggc tgcatgggggtgtcttgtcttgtgatgtga

DBGET integrated database retrieval system