Crotalus tigris (Tiger rattlesnake): 120314809 Help Entry 120314809         CDS       T08476                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig04814   Motor proteins ctig05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ctig00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120314809 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120314809 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ctig03037]     120314809 (DYNLT1)    04812 Cytoskeleton proteins [BR:ctig04812]     120314809 (DYNLT1) Cilium and associated proteins [BR:ctig03037]  Motile cilia and associated proteins   Dynein arm    120314809 (DYNLT1) Cytoskeleton proteins [BR:ctig04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120314809 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  120314809 NCBI-ProteinID:  XP_039214221 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDELQSAEETAFVVDEVSNIIKEAVEGTIGGNAYLHSKVNQWTTTVVEQILSQLTKLGKP FKYVVTCVIMQKNGAGLHTANSCFWDNAADGACTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagctccaatctgccgaggagactgcatttgttgtggacgaagtaagcaacatt ataaaagaggccgtagaaggaacaataggtggcaatgcatatctgcacagcaaagtgaac caatggactacaactgttgtggagcagattttaagtcagttgacaaagctggggaaacca ttcaaatatgttgtgacctgtgtgattatgcaaaaaaatggtgctggacttcacactgca aactcttgcttctgggacaatgccgctgatggagcctgcactgtaagatgggagaacaag actatgtactgtattgtcagtgccttcggacttgcaatataa

DBGET integrated database retrieval system