Crotalus tigris (Tiger rattlesnake): 120318809 Help Entry 120318809         CDS       T08476                                  Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism ctig  Crotalus tigris (Tiger rattlesnake) Pathway ctig03082   ATP-dependent chromatin remodeling ctig04217   Necroptosis Brite KEGG Orthology (KO) [BR:ctig00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120318809  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120318809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ctig03036]     120318809   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctig04147]     120318809 Chromosome and associated proteins [BR:ctig03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120318809 Exosome [BR:ctig04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120318809 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120318809 NCBI-ProteinID:  XP_039222820 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaggctggcaaagacagtggcaaggccaaggcaaaggcagtatctcgc tcgcaaagagctgggcttcagttcccagtgggccgtatccacagacacttgaagactcgc accacaagccacggaagggttggtgctacagctgccgtgtacagtgctgcaattcttgaa tatctcactgctgaggttttggagttggcaggcaacgcctccaaggatcttaaggtaaaa cgtataactcctcgtcatttgcagctggctattcgtggggatgaggagttggattctctt attaaagcgaccattgctggtggaggcgtaattccgcacatccacaagtctctgattgga aagaagggacagcagaagaccgcataa

DBGET integrated database retrieval system