Chlamydia trachomatis J/6276tet1: CTJTET1_01230 Help Entry CTJTET1_01230     CDS       T02762                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctjt  Chlamydia trachomatis J/6276tet1 Pathway ctjt01100   Metabolic pathways ctjt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctjt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTJTET1_01230 (acpP)    00074 Mycolic acid biosynthesis     CTJTET1_01230 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTJTET1_01230 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGS02029 LinkDB All DBs Position complement(264212..264445) Genome browser AA seq 77 aa AA seqDB search MSLEDDVKAIIVDQLGVSPEDVKVDSSFIEDLNADSLDLTELIMTLEEKFAFEISEDDAE QLRTVGDVIKYIQERQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattatagttgatcagctcggagtaagtcctgag gatgtcaaagtagactcttctttcatagaagatctaaatgcagacagcttggatttgaca gagttgattatgactttagaagagaaatttgcttttgaaatttctgaagatgatgccgag caactccgcacagtcggtgacgtgattaaatacatccaagagcgtcaaaactaa

DBGET integrated database retrieval system