Candida tropicalis: CTRG_00044 Help Entry CTRG_00044        CDS       T01115                                  Name (RefSeq) 60S ribosomal protein L40   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ctp  Candida tropicalis Pathway ctp03010   Ribosome ctp04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ctp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     CTRG_00044   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     CTRG_00044  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ctp03011]     CTRG_00044    04121 Ubiquitin system [BR:ctp04121]     CTRG_00044 Ribosome [BR:ctp03011]  Ribosomal proteins   Eukaryotes    Large subunit     CTRG_00044   Archaea     CTRG_00044 Ubiquitin system [BR:ctp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    CTRG_00044 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  8297235 NCBI-ProteinID:  XP_002545263 UniProt:  C5M1V5 LinkDB All DBs Position Unknown AA seq 52 aa AA seqDB search MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgattgaaccatccttgaaagctttagcttccaaatacaactgtgaaaaatccatttgt cgtaaatgttacgctagattgccaccaagagccaccaactgtcgtaagagaaagtgtggt cacaccaaccaattgagaccaaagaagaagttaaagtag

DBGET integrated database retrieval system