Candida tropicalis: CTRG_00206 Help Entry CTRG_00206        CDS       T01115                                  Name (RefSeq) hypothetical protein   KO K27246   non-histone chromosomal protein 6 Organism ctp  Candida tropicalis Brite KEGG Orthology (KO) [BR:ctp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ctp03036]     CTRG_00206 Chromosome and associated proteins [BR:ctp03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      CTRG_00206 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 CHDNT Motif Other DBs NCBI-GeneID:  8301879 NCBI-ProteinID:  XP_002545425 UniProt:  C5M2B7 LinkDB All DBs Position Unknown AA seq 66 aa AA seqDB search MFFANENRDIVRAENPGISFGQVGKLLGEKWKALTPEDKTPYENKAEADKKRYEKEKAEY AKKNSN NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgtttttcgctaacgaaaacagagatatcgttagagctgaaaacccaggtatctccttt ggtcaagttggtaaattattaggtgaaaaatggaaggctttaactccagaagataagact ccatatgaaaacaaggccgaagctgataaaaagagatatgaaaaagaaaaagctgaatat gctaaaaaaaattctaactaa

DBGET integrated database retrieval system