Chlamydia trachomatis D/UW-3/CX: CT_236 Help Entry CT_236            CDS       T00017                                  Symbol acpP Name (RefSeq) acyl carrier protein   KO K02078   acyl carrier protein Organism ctr  Chlamydia trachomatis D/UW-3/CX Pathway ctr01100   Metabolic pathways ctr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CT_236 (acpP)    00074 Mycolic acid biosynthesis     CT_236 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CT_236 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-GeneID:  884884 NCBI-ProteinID:  NP_219741 UniProt:  O84239 LinkDB All DBs Position complement(263702..263935) Genome browser AA seq 77 aa AA seqDB search MSLEDDVKAIIVDQLGVSPEDVKVDSSFIEDLNADSLDLTELIMTLEEKFAFEISEDDAE QLRTVGDVIKYIQERQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattatagttgatcagctcggagtaagtcctgag gatgtcaaagtagactcttctttcatagaagatctaaatgcagacagcttggatttgaca gagttgattatgactttagaagagaaatttgcttttgaaatttctgaagatgatgccgag caactccgcacagtcggtgacgtgattaaatacatccaagagcgtcaaaactaa

DBGET integrated database retrieval system