Chlamydia trachomatis IU888: BN442_1121 Help Entry BN442_1121        CDS       T02540                                  Symbol groES Name (GenBank) 10 kDa chaperonin GroES   KO K04078   chaperonin GroES Organism ctra  Chlamydia trachomatis IU888 Brite KEGG Orthology (KO) [BR:ctra00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ctra03110]     BN442_1121 (groES)    03029 Mitochondrial biogenesis [BR:ctra03029]     BN442_1121 (groES) Chaperones and folding catalysts [BR:ctra03110]  Heat shock proteins   HSP10    BN442_1121 (groES) Mitochondrial biogenesis [BR:ctra03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BN442_1121 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Yqai Motif Other DBs NCBI-ProteinID:  CCP28802 LinkDB All DBs Position complement(128799..129107) Genome browser AA seq 102 aa AA seqDB search MSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKKKQDRAEVLALGTGKKDDKGQ QLPFEVQVGDIVLIDKYSGQELTVEGEEYVIVQMSEVIAVLQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcagatcaagcaacgaccctcaagattaaacctttgggagatagaattttagttaaa agagaagaagaagcttccactgcaagaggcggaatcattcttcctgacactgccaagaaa aagcaagatagagctgaagttttagctctaggaacaggcaaaaaagatgataaagggcag caacttccttttgaagttcaggttggtgacatcgttttaattgataaatattctggccaa gaactcactgtagaaggtgaagagtacgtcatcgttcaaatgagcgaagttatcgcagtt ctgcaataa

DBGET integrated database retrieval system