Chlamydia trachomatis D/SotonD1: SOTOND1_00246 Help Entry SOTOND1_00246     CDS       T02551                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctrd  Chlamydia trachomatis D/SotonD1 Pathway ctrd01100   Metabolic pathways ctrd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctrd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SOTOND1_00246    00074 Mycolic acid biosynthesis     SOTOND1_00246   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SOTOND1_00246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCP52416 LinkDB All DBs Position complement(264293..264526) Genome browser AA seq 77 aa AA seqDB search MSLEDDVKAIIVDQLGVSPEDVKVDSSFIEDLNADSLDLTELIMTLEEKFAFEISEDDAE QLRTVGDVIKYIQERQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattatagttgatcagctcggagtaagtcctgag gatgtcaaagtagactcttctttcatagaagatctaaatgcagacagcttggatttgaca gagttgattatgactttagaagagaaatttgcttttgaaatttctgaagatgatgccgag caactccgcacagtcggtgacgtgattaaatacatccaagagcgtcaaaactaa

DBGET integrated database retrieval system