Chlamydia trachomatis D/SotonD1: SOTOND1_00546
Help
Entry
SOTOND1_00546 CDS
T02551
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
ctrd
Chlamydia trachomatis D/SotonD1
Pathway
ctrd03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
ctrd00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
SOTOND1_00546
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
ctrd03011
]
SOTOND1_00546
Ribosome [BR:
ctrd03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
SOTOND1_00546
Bacteria
SOTOND1_00546
Archaea
SOTOND1_00546
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF896
Motif
Other DBs
NCBI-ProteinID:
CCP52705
LinkDB
All DBs
Position
complement(589528..589899)
Genome browser
AA seq
123 aa
AA seq
DB search
MESSLYKKTSGKARRALRVRKALKGCSLKPRLSVVKTNKHVYVQLIDDVEGKTLVSISTL
AKVAKTSGLTRKNQDNAKALGIKIAELGKGLQVDRVIFDRGAHKYHGVVAMVADGAREGG
LQF
NT seq
372 nt
NT seq
+upstream
nt +downstream
nt
atggaaagctctttatataagaaaacttcggggaaagctcgtagagctttaagagtgcgg
aaagccttaaagggatgttctttaaagcccagattatccgttgtaaagacaaataagcat
gtttatgtgcagctgattgatgatgttgaagggaaaactttagtatctatttcaactttg
gctaaggttgcaaaaacttctggattaactagaaaaaatcaggataatgccaaagctttg
ggaataaaaattgctgaattagggaaaggccttcaagtagatcgagttattttcgatcga
ggagctcataagtatcatggtgtagtagctatggttgctgatggagccagagagggtgga
ttacagttttaa
DBGET
integrated database retrieval system