KEGG   Chlamydia trachomatis L3/404/LN: L3404_00705
Entry
L3404_00705       CDS       T02550                                 
Name
(GenBank) hypothetical protein
  KO
K04056  type III secretion protein O
Organism
ctrn  Chlamydia trachomatis L3/404/LN
Pathway
ctrn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ctrn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    L3404_00705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ctrn02044]
    L3404_00705
Secretion system [BR:ctrn02044]
 Type III secretion system
  Type III secretion core apparatus
   L3404_00705
SSDB
Motif
Pfam: YscO-like YscO FliJ Imm49
Other DBs
NCBI-ProteinID: CCP67164
LinkDB
Position
763748..764254
AA seq 168 aa
MVRYPLEPVLSIKKDRVDRAEKVVKEKRRLLELEQEKLRERESERDKVKNHYMQKIRQLR
EQLDDGTTSDAILKMKAYIKVVAIQLSEEEEKVNKQKENVLAAAKELERAEVELTKRRKE
EEKTRLHKEEWMKEALKEEARQEEKEQDEMGQLLHQLLKQKQRESGEN
NT seq 507 nt   +upstreamnt  +downstreamnt
gtggttagatatcctttagaacctgtcttatctattaagaaggatcgtgtagacagagca
gagaaggttgttaaggagaaacgcagacttttagagttagaacaagagaaattgcgtgaa
cgcgaatcggagcgtgataaagttaagaatcactatatgcagaaaattcgccagctccgc
gagcaattagatgacggaacaaccagcgatgcgattcttaaaatgaaagcgtatatcaaa
gtagttgcgatacagctttctgaagaagaagaaaaggtcaataagcagaaagaaaatgtg
ctggcagcagcaaaggagctggaaagggctgaagtagagctgaccaaacgacgtaaagaa
gaagaaaaaactcgactgcataaagaagaatggatgaaagaagctctgaaagaagaggct
cgccaggaagaaaaagagcaagatgagatggggcagttgcttcatcaattacttaagcaa
aaacaacgggaatctggggagaactaa

DBGET integrated database retrieval system