Comamonas thiooxydans: CtCNB1_0422
Help
Entry
CtCNB1_0422 CDS
T01109
Name
(GenBank) aminotransferase, class I and II
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
ctt
Comamonas thiooxydans
Pathway
ctt00300
Lysine biosynthesis
ctt00630
Glyoxylate and dicarboxylate metabolism
ctt01100
Metabolic pathways
ctt01110
Biosynthesis of secondary metabolites
ctt01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
ctt00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
CtCNB1_0422
09105 Amino acid metabolism
00300 Lysine biosynthesis
CtCNB1_0422
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
Diphtheria_R
Motif
Other DBs
NCBI-ProteinID:
ACY31168
LinkDB
All DBs
Position
complement(465678..466859)
Genome browser
AA seq
393 aa
AA seq
DB search
MTTWTLAERAAKMNSSAIREILKLTDRPGIISMAGGLPSPKAFPLDAFTEACQTVMQRDG
AAALQYSTTEGFAPLRQAIADFLPWNVDPEQILITTGSQQALDLIGKVFLDKGSRLLVEK
PTYLGALQAFTPMEPVAVGVDSDDEGMLIDDFAKQIGSGADKARLAYVLPNFQNPTGRTM
SDARRQALVDKARELDIPLIEDNPYGDLWYEQEPPLPLAARNPEGVIYMGSFSKVLAPGL
RIGFIVAPKSVYGKLTQAKQAADLHTPSFNQRVVAEVIKDGFLDRHVPTIRAMYKTQRDV
MLMALEREMAGLDVKWTRPVGGMFLWVRLPAGMDAQALLAKAVERNMAFVPGAPFYAGDA
QNNTLRLSYVTVSAEQINIGIAALADAIRSNTP
NT seq
1182 nt
NT seq
+upstream
nt +downstream
nt
atgacaacatggacgctggcagaacgtgctgccaagatgaattcctccgccatccgcgag
atcctcaagctgaccgaccgccccggcatcatcagcatggctggcggcctgccttccccc
aaggccttccctctggatgcgttcaccgaagcctgccagaccgtgatgcagcgcgacggt
gccgcagccctgcagtactcgaccaccgagggctttgccccgctgcgtcaggcgattgcc
gacttcctgccctggaacgtcgatcccgagcagatcctgatcaccaccggcagccagcag
gcgctggacctgatcggcaaggtattcctggacaagggcagccgtttgctggttgaaaag
cccacctacctgggcgccctgcaggccttcacccccatggagcctgtggccgtgggcgtg
gacagcgatgacgaaggcatgctgatcgacgatttcgccaaacagatcggcagcggcgcc
gacaaggcccgtctggcctatgtgctgcccaacttccagaaccccaccggccgcaccatg
agcgatgcgcgccgccaggctctggtcgacaaggccagggagctggacattcccctgatc
gaggacaacccctacggcgacctctggtacgaacaggagcctcccctgcccctggctgca
cgcaaccccgagggcgtgatctacatgggctcgttctccaaggtgcttgccccgggcctg
cgcatcggcttcatcgtcgcgcccaagtccgtctacggcaagctgacccaggccaagcag
gccgccgacctgcacacccccagcttcaatcagcgcgtagtggccgaagtcatcaaggac
ggcttcctggaccgccatgtacccaccatccgagccatgtacaagactcagcgcgatgtg
atgctgatggctctggagcgcgagatggccggcctcgacgtgaagtggacacgtcccgtg
ggcggcatgttcctctgggtcaggctgcctgcaggcatggacgcccaggccctgctggcc
aaggccgtggagcgcaatatggcttttgtgcccggcgcgcccttctacgccggcgatgcg
cagaacaacacgctgcgcctgtcctacgtgacagtgtctgccgagcagatcaatattggc
attgctgctctggctgacgccatccgcagcaacaccccctga
DBGET
integrated database retrieval system