Comamonas thiooxydans: CtCNB1_0973 Help Entry CtCNB1_0973       CDS       T01109                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctt  Comamonas thiooxydans Pathway ctt01100   Metabolic pathways ctt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CtCNB1_0973    00074 Mycolic acid biosynthesis     CtCNB1_0973   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CtCNB1_0973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  ACY31719 UniProt:  A0A096G9P9 LinkDB All DBs Position 1098989..1099228 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgaacaactcggcgttgaagag tcccaagtgaccaacgaaaaggccttcgtggctgacctgggcgctgactccctggacaca gtggaactggtgatggccctggaagatgaattcggcatcgagatccctgacgaagacgca gagaagatcacgacggtgcaaaacgccatcgactacgccaatacccaccaaaaggcctaa

DBGET integrated database retrieval system