Comamonas thiooxydans: CtCNB1_3548 Help Entry CtCNB1_3548       CDS       T01109                                  Name (GenBank) putative prophage repressor   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism ctt  Comamonas thiooxydans Brite KEGG Orthology (KO) [BR:ctt00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ctt01002]     CtCNB1_3548   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ctt03400]     CtCNB1_3548 Peptidases and inhibitors [BR:ctt01002]  Serine peptidases   Family S24: LexA family    CtCNB1_3548 DNA repair and recombination proteins [BR:ctt03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     CtCNB1_3548 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 DUF1287 Motif Other DBs NCBI-ProteinID:  ACY34294 LinkDB All DBs Position 4015447..4015689 Genome browser AA seq 80 aa AA seqDB search MREYGIDDGDIIVVDRALRARHGSIVVALLDNDFTVKVLHNAGGCFKLRAGNPTYPDIVP KENQELEIWGVVKSCIKRFA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcgcgagtacggcatcgatgacggcgacatcatcgtggtcgaccgcgcgcttcgcgct cgccatggcagcatcgtggtggccttgcttgataacgacttcaccgtcaaggtgctgcac aacgcgggcggctgcttcaagctcagggccggcaaccccacctaccccgacatcgtcccc aaagagaaccaagagctagaaatctggggcgtggtcaagtcctgcatcaaacgctttgca tga

DBGET integrated database retrieval system