Cronobacter turicensis: CTU_39920 Help Entry CTU_39920         CDS       T00999                                  Symbol acpP2 Name (GenBank) Acyl carrier protein 2   KO K02078   acyl carrier protein Organism ctu  Cronobacter turicensis Pathway ctu01100   Metabolic pathways ctu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTU_39920 (acpP2)    00074 Mycolic acid biosynthesis     CTU_39920 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTU_39920 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding GshA Motif Other DBs NCBI-ProteinID:  CBA34316 UniProt:  C9Y2G7 LinkDB All DBs Position 4143560..4143811 Genome browser AA seq 83 aa AA seqDB search MVDQHAIYQEVSGLLVKLFEIDPADITPQARLYEDLELDSIDAVDMVVHLQKKTGKKIKP EIFKSVRTVQDVVDAVERLLSEE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggttgatcaacacgctatttatcaggaagtttccggcctcctcgtcaaattattcgaa atcgatccggcggacattaccccgcaggccagactgtatgaagacctggagctggacagc attgatgcagtggatatggttgtccatctgcaaaaaaagaccggcaaaaaaattaagccg gagatttttaaatccgtccgcaccgttcaggatgtggtggacgcggttgagcgtctgctg agcgaagaataa

DBGET integrated database retrieval system