KEGG   Corynebacterium tuberculostearicum: I6I74_07660
Entry
I6I74_07660       CDS       T07593                                 
Name
(GenBank) MFS transporter
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
ctub  Corynebacterium tuberculostearicum
Brite
KEGG Orthology (KO) [BR:ctub00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctub02000]
    I6I74_07660
Transporters [BR:ctub02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    I6I74_07660
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_2 DUF4149
Other DBs
NCBI-ProteinID: QQU81125
LinkDB
Position
1612729..1613982
AA seq 417 aa
MKIIDELSPRSAHEHRVRRRPLPLQTEITTRRRAIVMVAMALGAFAIGTTEFVSMGLLPL
IADDFGVSEENASTLITIYAMGVVVGAPLIAAFTGKLPRRRLILLLIGFLVVGNLLSVLA
PNYAILMVARFIAGMPHGAYFSVANLSAASMAPPGGRGKAMAYVGMGLAIATVIGVPAAQ
ALGSALGWQAAYLVVVALGIVTAIALFFLMPHMTEMKQTDIRTEFGAFKNSQVWFTVIMG
VVGFGGMFSVYTYISWTMTEVAGMDQSLIWVVLMAYGIGMTIGNAFGGWLADRNLEFGII
FALACLIVILTAFYFLSGHAIPATLCFGCVAFMGSTLVPSLQLRLVHVAGDAQTLAAALN
QSALNIANAAGATIGGAVVGAGLGYSAPALAGAALAAAGCLVWAATMWDKKRLSRRA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaaaatcatcgatgagctaagcccgcgcagcgcacacgaacaccgcgttcgccgccgc
ccgctgccgctgcaaacggagattaccacccgccgccgcgccatcgtcatggtggccatg
gccttgggcgcgtttgccatcggcacgacggagttcgtgtccatgggcctgctgccgctt
attgcagatgattttggcgtttcggaagaaaacgcctccacactcatcaccatctatgcc
atgggcgtggtggtcggtgccccgttgattgcggcttttaccggcaagctgccgcgccgc
cggctcatcctgctgctcatcggcttcctcgtggtgggcaacctcctctcggtcttggca
ccgaattacgccatcctcatggtcgcgcgctttattgcgggcatgccgcacggcgcttat
ttctccgtggctaatctctcggccgcatccatggcgccccctggcggccgcggcaaggcc
atggcttatgtgggcatgggcttggccatcgccacggtgattggtgtgccggccgcccaa
gccctcggctccgcgctgggctggcaggcggcctacctagtggtcgtggctttgggtatt
gtcaccgccattgcgttgttcttcctgatgccgcacatgacggagatgaagcagaccgat
atccgcaccgaatttggtgcgttcaaaaacagtcaggtgtggttcaccgtcatcatgggc
gtggtcggctttggcggcatgttctccgtctatacctatatttcgtggaccatgaccgag
gtcgccggcatggaccagagcctcatctgggtggtgctcatggcctatggcatcggcatg
accatcggcaatgcctttggcggctggcttgccgatcgcaacctggagtttggcattatc
tttgccttggcctgcctcatcgttatcctgacggccttctacttcctctccggccatgcc
atccccgctaccttgtgctttggctgcgtggcgtttatgggctccacgctggttccttcg
ctgcagctgcgcttggtgcatgtggctggcgacgcccagactttggccgcagcccttaac
cagtccgcgctgaacatcgcaaacgcggccggtgcgaccattggcggcgccgtggtgggt
gccggcttgggctactccgccccggcgctggccggtgcggccctagcggctgcgggttgc
ctggtatgggctgcgacgatgtgggataaaaagcgcctttctcgccgcgcctag

DBGET integrated database retrieval system