Chryseobacterium sp. C-71: LNP04_15030 Help Entry LNP04_15030       CDS       T08775                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ctur  Chryseobacterium sp. C-71 Brite KEGG Orthology (KO) [BR:ctur00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ctur03032]     LNP04_15030    03036 Chromosome and associated proteins [BR:ctur03036]     LNP04_15030    03400 DNA repair and recombination proteins [BR:ctur03400]     LNP04_15030 DNA replication proteins [BR:ctur03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LNP04_15030 Chromosome and associated proteins [BR:ctur03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LNP04_15030 DNA repair and recombination proteins [BR:ctur03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LNP04_15030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  UFH31275 LinkDB All DBs Position complement(3264522..3264812) Genome browser AA seq 96 aa AA seqDB search MNKSELIDAIAKDAGITKVAAKAALESFISNVTTTLKAKDGKVSLVGFGTFSVSERAARQ GINPATKKPIKIAAKTVAKFKAGADLATAVSGVKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaatcgcaaaagacgcaggtattactaaagttgca gctaaagctgctttagagtcttttatctctaacgttacaacaactctaaaggcaaaagac ggaaaagtgtctttagtaggatttggtactttctcagtatctgagagagctgcaagacaa ggtatcaaccctgcaactaaaaaaccaatcaaaatcgctgctaaaacagtagctaaattt aaggctggtgctgacttggcaactgcggtttcaggtgtgaaaaagaaataa

DBGET integrated database retrieval system