Chlamydia trachomatis G/9768: G9768_01215 Help Entry G9768_01215       CDS       T01907                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ctw  Chlamydia trachomatis G/9768 Pathway ctw01100   Metabolic pathways ctw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ctw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G9768_01215 (acpP)    00074 Mycolic acid biosynthesis     G9768_01215 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G9768_01215 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADH17926 LinkDB All DBs Position complement(264204..264437) Genome browser AA seq 77 aa AA seqDB search MSLEDDVKAIIVDQLGVSPEDVKVDSSFIEDLNADSLDLTELIMTLEEKFAFEISEDDAE QLRTVGDVIKYIQERQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattatagttgatcagctcggagtaagtcctgag gatgtcaaagtagactcttctttcatagaagatctaaatgcagacagcttggatttgaca gagttgattatgactttagaagagaaatttgcttttgaaatttctgaagatgatgccgag caactccgcacagtcggtgacgtgattaaatacatccaagagcgtcaaaactaa

DBGET integrated database retrieval system