Cotesia typhae: 141524141 Help Entry 141524141         CDS       T11099                                  Symbol Rab7 Name (RefSeq) RAS oncogene family member Rab7   KO K07897   Ras-related protein Rab-7A Organism ctyp  Cotesia typhae Pathway ctyp04137   Mitophagy - animal ctyp04140   Autophagy - animal ctyp04144   Endocytosis ctyp04145   Phagosome ctyp04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ctyp00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141524141 (Rab7)    04145 Phagosome     141524141 (Rab7)    04140 Autophagy - animal     141524141 (Rab7)    04137 Mitophagy - animal     141524141 (Rab7)    04148 Efferocytosis     141524141 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctyp04131]     141524141 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctyp04147]     141524141 (Rab7)    04031 GTP-binding proteins [BR:ctyp04031]     141524141 (Rab7) Membrane trafficking [BR:ctyp04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     141524141 (Rab7) Exosome [BR:ctyp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141524141 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    141524141 (Rab7)   Exosomal proteins of colorectal cancer cells    141524141 (Rab7)   Exosomal proteins of bladder cancer cells    141524141 (Rab7) GTP-binding proteins [BR:ctyp04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     141524141 (Rab7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 AAA_16 PduV-EutP Septin AAA_22 AAA_7 AAA_24 NTPase_1 AAA_5 G-alpha ATPase_2 AAA_14 NACHT SRPRB NB-ARC ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  141524141 NCBI-ProteinID:  XP_074093913 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVAAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLENRAVSSKRAHQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcatcccgcaagaaagtactactgaaagtaattatcctcggggattccggagtcgga aaaacttccctgatgaatcagtacgtcaacaaaaaatttagcaaccagtacaaagcaact attggagctgattttttgactaaagaagtaatggtcgatgataggatagttactatgcag atttgggatacagcaggacaagaaagattccaatcactgggagttgcattttatcgaggc gctgattgttgcgtactagtatttgacgtcgcagctccaacctccttcaaatcattagat tcatggcgagacgaatttttaatccaagcttcaccccgagaccccgataattttccattt gtcgtgctcggcaacaaagtcgatcttgagaacagagctgtctccagtaagagagcacac cagtggtgtcaatcaaaaaataatatcccgtactttgaaacgagcgctaaagaagctatt aatgtcgaacaagctttccagacgatagctaaaaatgctttggcccaagaaagcgaggtg gaactgtataacgaatttccagatcaaataaaactcactaacgatcaaagaagtaatggc aagggtgattcatgtgcctgctag

DBGET integrated database retrieval system