Cotesia typhae: 141530503 Help Entry 141530503         CDS       T11099                                  Symbol Sec61beta Name (RefSeq) sec61 translocon subunit beta   KO K09481   protein transport protein SEC61 subunit beta Organism ctyp  Cotesia typhae Pathway ctyp03060   Protein export ctyp04141   Protein processing in endoplasmic reticulum ctyp04145   Phagosome Brite KEGG Orthology (KO) [BR:ctyp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     141530503 (Sec61beta)    04141 Protein processing in endoplasmic reticulum     141530503 (Sec61beta)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     141530503 (Sec61beta)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctyp04131]     141530503 (Sec61beta)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ctyp02044]     141530503 (Sec61beta) Membrane trafficking [BR:ctyp04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     141530503 (Sec61beta) Secretion system [BR:ctyp02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    141530503 (Sec61beta) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  141530503 NCBI-ProteinID:  XP_074103738 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MPAAPSSTNVGAAGRSPSRAVAPRTSGAGTVRQRKTAPATSARNRNTGTSSGGMWRFYTD DSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRS NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgccggctgcaccgagttcaacaaatgttggagctgcaggtcgttcaccaagcagagct gtcgcacctagaacaagtggtgctggtacagtgagacaacgtaagacagcaccagcaacg tcagctagaaaccgcaacactggtactagctccggtggaatgtggagattttacactgat gattcacctggcatcaaagttggaccagttccagttcttgttatgtctcttttgttcatc gcatcggtgtttatgttacacatctggggtaaatacacgagatcgtag

DBGET integrated database retrieval system