Cotesia typhae: 141530774 Help Entry 141530774         CDS       T11099                                  Symbol Mtl Name (RefSeq) rac family small GTPase Mtl   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ctyp  Cotesia typhae Pathway ctyp04013   MAPK signaling pathway - fly ctyp04145   Phagosome ctyp04148   Efferocytosis ctyp04310   Wnt signaling pathway ctyp04620   Toll-like receptor signaling pathway ctyp05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ctyp00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     141530774 (Mtl)    04310 Wnt signaling pathway     141530774 (Mtl)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     141530774 (Mtl)    04148 Efferocytosis     141530774 (Mtl)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     141530774 (Mtl)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     141530774 (Mtl)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ctyp04131]     141530774 (Mtl)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctyp04147]     141530774 (Mtl)    04031 GTP-binding proteins [BR:ctyp04031]     141530774 (Mtl) Membrane trafficking [BR:ctyp04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     141530774 (Mtl)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     141530774 (Mtl)   Macropinocytosis    Ras GTPases     141530774 (Mtl)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     141530774 (Mtl) Exosome [BR:ctyp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141530774 (Mtl)   Exosomal proteins of other body fluids (saliva and urine)    141530774 (Mtl)   Exosomal proteins of colorectal cancer cells    141530774 (Mtl)   Exosomal proteins of bladder cancer cells    141530774 (Mtl) GTP-binding proteins [BR:ctyp04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     141530774 (Mtl) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  141530774 NCBI-ProteinID:  XP_074104191 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MSSGRPIKCVVVGDGTVGKTCMLISYTTDSFPGEYVPTVFDNYSAPMVVDGIPISLGLWD TAGQEDYDRLRPLSYPQTDVFLICFSVTSPSSFENVTSKWYPEIKHHCPDAPMILVGTKI DLRDDRETLTLLAEQGLSAIKREQGQKLANKIRAVKYMECSALTQRGLKQVFDEAIRAVL RPEPQKRRQRRCTLL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgagttcaggtaggccaattaagtgtgtcgtggttggagatgggacagttggaaaaacc tgtatgttgatatcttatacaacagatagttttcctggtgaatatgtgcctactgtattt gataattactcagcaccaatggtagtcgatggaattcctatcagcttaggtctgtgggat actgctggacaagaagactacgatagattaagaccattgtcatatccacaaacagacgta tttttaatttgtttctcggtaacaagtccatcgtcatttgaaaatgttactagcaagtgg tatccggaaataaagcaccactgtcctgatgcacctatgatccttgttggtacaaagatt gatttacgtgatgatcgtgaaacattgactttacttgctgaacaaggattaagtgccatc aagcgtgaacaaggacaaaaattagctaataagatacgagcagtcaaatacatggagtgt tcagcgttgacgcaaaggggtttaaaacaagtttttgatgaagcaatacgtgccgtactg cgacctgaacctcagaaacgtcgtcagagaagatgtaccctactgtaa

DBGET integrated database retrieval system