Cotesia typhae: 141536695 Help Entry 141536695         CDS       T11099                                  Symbol Rps27a Name (RefSeq) ribosomal protein S27A   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ctyp  Cotesia typhae Pathway ctyp03010   Ribosome ctyp04120   Ubiquitin mediated proteolysis ctyp04137   Mitophagy - animal ctyp04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:ctyp00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     141536695 (Rps27a)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     141536695 (Rps27a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141536695 (Rps27a)    04137 Mitophagy - animal     141536695 (Rps27a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ctyp03011]     141536695 (Rps27a)    04121 Ubiquitin system [BR:ctyp04121]     141536695 (Rps27a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ctyp04147]     141536695 (Rps27a) Ribosome [BR:ctyp03011]  Ribosomal proteins   Eukaryotes    Small subunit     141536695 (Rps27a)   Archaea     141536695 (Rps27a) Ubiquitin system [BR:ctyp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    141536695 (Rps27a) Exosome [BR:ctyp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141536695 (Rps27a)   Exosomal proteins of colorectal cancer cells    141536695 (Rps27a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD Dsc3_N IBR DUF2604 Ubiquitin_5 TBK1_ULD OTU1_UBXL UBL_UBAC1 RPAP2_Rtr1 Motif Other DBs NCBI-GeneID:  141536695 NCBI-ProteinID:  XP_074113497 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKKKKVKLAVLKFYKVDENGKIHRLRRE CPSEQCGAGVFMAAMEDRHYCGKCGYTLVFNKPEDK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgcagatttttgtaaaaacactcacaggaaagaccatcacccttgaggttgaagcgtct gacactatcgaaaatgtcaaggccaaaatccaagacaaagagggaatcccaccagatcag caaagattgatcttcgctggtaaacagttggaggatggaagaaccttgtccgactacaac atccagaaagagtcaactttacatctggtgttgagacttcgtggtggagccaagaaacgc aagaagaagaattactccacccccaagaagatcaagcacaagaagaagaaggtcaagctc gctgtcctcaagttctacaaggttgatgagaatggaaaaattcatcgtttgagacgtgag tgtccttctgaacaatgcggtgctggtgttttcatggctgccatggaagaccgtcattac tgtggaaaatgcggttacacactagtttttaacaaacctgaagacaagtaa

DBGET integrated database retrieval system