Curtobacterium sp. BH-2-1-1: BJK06_11345 Help Entry BJK06_11345       CDS       T04562                                  Name (GenBank) hypothetical protein   KO K03117   sec-independent protein translocase protein TatB Organism cub  Curtobacterium sp. BH-2-1-1 Pathway cub03060   Protein export cub03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cub00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BJK06_11345  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     BJK06_11345  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cub02044]     BJK06_11345 Secretion system [BR:cub02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    BJK06_11345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_31 TatA_B_E DUF4268 Motif Other DBs NCBI-ProteinID:  AOX66271 LinkDB All DBs Position 2369920..2370222 Genome browser AA seq 100 aa AA seqDB search MDAEKLIVIGIVAAVFVGPHRLVGLAQQLAGFVRQLRHWAESTKAQVEEEIGVEIDWSEL DPRRYDPRRIIRDALTHPTSASESGERASAATAVTHETQQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtggacgccgagaagctgatcgtcatcgggatcgtcgccgcggtcttcgtcggaccgcac cgcctcgtcggtctcgcgcagcagctggccgggttcgtccgacagctccgtcactgggcg gaatccacgaaggcccaggtcgaggaggagatcggcgtcgagatcgactggtccgagctc gacccgcgtcggtacgacccgcgccggatcatccgtgatgcgttgacgcacccgacgtca gcgagcgagtcgggggagcgggcgtcagcggcgacggctgtcacccatgagactcagcag tga

DBGET integrated database retrieval system