Cuculus canorus (common cuckoo): 104060544 Help Entry 104060544         CDS       T08597                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cuca00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104060544 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cuca03036]     104060544 (CENPS)    03400 DNA repair and recombination proteins [BR:cuca03400]     104060544 (CENPS) Chromosome and associated proteins [BR:cuca03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      104060544 (CENPS) DNA repair and recombination proteins [BR:cuca03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104060544 (CENPS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa TAF DUF1677 Bromo_TP DASH_Dad2 Motif Other DBs NCBI-GeneID:  104060544 NCBI-ProteinID:  XP_009560644 LinkDB All DBs Position 21:4725277..4728606 Genome browser AA seq 139 aa AA seqDB search MAAAESEERALLAQRLRAAVHYAVCGLCQEVAEDKAVQFSKQSLAAIAELTFRQCETFAR DLEMFARHAKRSTITTEDVKLLARRSNSLLKYITQKSEELASSNMEQKEKKKKSSASKGG RMHREEEAAVTESEDSNMA NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggagagcgaggagcgggcgctgctcgcccagaggctgagggccgccgtg cactacgccgtgtgcgggctgtgccaggaggtggcggaggacaaggcggtgcagttcagc aagcagagcctggcggctatcgcggagctcaccttccggcagtgcgaaacttttgcaaga gacctcgaaatgtttgcaaggcatgccaaacgaagcacaatcactacagaagatgtgaag cttttggctagaaggagcaattctttgctaaagtacatcacccagaagagtgaagagctt gcatcgagtaacatggagcaaaaggagaagaagaagaagtccagtgcctcaaagggaggg agaatgcacagggaagaagaagcagctgtgactgagagtgaggattccaacatggcatga

DBGET integrated database retrieval system