Cuculus canorus (common cuckoo): 104061474 Help Entry 104061474         CDS       T08597                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04145   Phagocytosis cuca04814   Motor proteins cuca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cuca00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104061474 (DYNLT1)   09142 Cell motility    04814 Motor proteins     104061474 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104061474 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cuca03037]     104061474 (DYNLT1)    04812 Cytoskeleton proteins [BR:cuca04812]     104061474 (DYNLT1) Cilium and associated proteins [BR:cuca03037]  Motile cilia and associated proteins   Dynein arm    104061474 (DYNLT1) Cytoskeleton proteins [BR:cuca04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104061474 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  104061474 NCBI-ProteinID:  XP_053918187 LinkDB All DBs Position 3 Genome browser AA seq 113 aa AA seqDB search MDDFQSGEETSFVVDEVSGIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccagtcaggggaagagacttcctttgttgttgatgaagtcagtggcatc attaaagaggccatagaaagcgccataggtggcaatgcctaccagcacagcaaagtgaac cagtggacgacaagtgtggtggagcaaactctgagccagctcacaaagctggggaagcct ttcaagtacattgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag actatgtactgtatcgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system