Cuculus canorus (common cuckoo): 104065248 Help Entry 104065248         CDS       T08597                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04810   Regulation of actin cytoskeleton cuca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cuca00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104065248 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104065248 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cuca04131]     104065248 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cuca04812]     104065248 (PFN2)    04147 Exosome [BR:cuca04147]     104065248 (PFN2) Membrane trafficking [BR:cuca04131]  Others   Actin-binding proteins    Others     104065248 (PFN2) Cytoskeleton proteins [BR:cuca04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104065248 (PFN2) Exosome [BR:cuca04147]  Exosomal proteins   Proteins found in most exosomes    104065248 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104065248 NCBI-ProteinID:  XP_053929978 LinkDB All DBs Position 9:25808840..25815080 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaagtacgtctgggcagccacggccggcggcatcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggagggtttcttc accaatggtctgacccttggtgcaaagaagtgctccgtgatcagagatagcctgtacgtc gatggcgactgcacgatggacatcaggacaaagagccaaggcggggagccgacgtacaac gttgctgtaggcagagctggtcgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system