Cuculus canorus (common cuckoo): 104065479 Help Entry 104065479         CDS       T08597                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cuca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104065479 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cuca04121]     104065479 (ELOB)    03400 DNA repair and recombination proteins [BR:cuca03400]     104065479 (ELOB) Ubiquitin system [BR:cuca04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      104065479 (ELOB)    Cul5 complex      104065479 (ELOB) DNA repair and recombination proteins [BR:cuca03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      104065479 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  104065479 NCBI-ProteinID:  XP_053909027 LinkDB All DBs Position 38 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVLELKRIVEGILKRPPEEQRLYKEEQLLEDAQTLGDC GFTSQTARPQAPATVGLALRCPGSGFEVLRIDPFSSPPELPDVMKPQEGGGGAPEPPLP NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagacgaccatcttcacggacgccaaggag tcaagcacagtcctggagctgaagcgtatcgtggaggggatcctcaagcggccacccgag gagcagcgcctctacaaggaggagcagctgctggaggacgctcagactcttggcgactgc ggcttcaccagccaaacggctcggccacaggccccggccaccgtggggctggcgctgcgc tgcccagggtccggctttgaggtgctgcgcatcgaccccttctcatcgccccctgaactc cctgatgtgatgaaacctcaggagggcggaggcggcgccccagagccccccctgccctga

DBGET integrated database retrieval system