Cuculus canorus (common cuckoo): 104067100 Help Entry 104067100         CDS       T08597                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04010   MAPK signaling pathway cuca04012   ErbB signaling pathway cuca04068   FoxO signaling pathway cuca04137   Mitophagy - animal cuca04140   Autophagy - animal cuca04150   mTOR signaling pathway cuca04210   Apoptosis cuca04218   Cellular senescence cuca04370   VEGF signaling pathway cuca04371   Apelin signaling pathway cuca04540   Gap junction cuca04625   C-type lectin receptor signaling pathway cuca04810   Regulation of actin cytoskeleton cuca04910   Insulin signaling pathway cuca04912   GnRH signaling pathway cuca04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cuca00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104067100 (NRAS)    04150 mTOR signaling pathway     104067100 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104067100 (NRAS)    04137 Mitophagy - animal     104067100 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cuca04131]     104067100 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cuca04147]     104067100 (NRAS)    04031 GTP-binding proteins [BR:cuca04031]     104067100 (NRAS) Membrane trafficking [BR:cuca04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104067100 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104067100 (NRAS) Exosome [BR:cuca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104067100 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104067100 (NRAS)   Exosomal proteins of breast cancer cells    104067100 (NRAS)   Exosomal proteins of colorectal cancer cells    104067100 (NRAS) GTP-binding proteins [BR:cuca04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104067100 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  104067100 NCBI-ProteinID:  XP_053943345 LinkDB All DBs Position 24:complement(3292278..3300537) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggcgccggcggcgtcggcaagagcgcgctcacc attcagctcatccagaaccacttcgtggatgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtcatcgatggagagacgtgcctgctggacatcctggacacggcgggg caggaggagtacagcgccatgcgcgaccagtacatgaggaccggggagggcttcctctgt gtctttgccattaacaacagcaaatcctttgctgacatcaacttgtacagagaacagatc aagagagtgaaagactcggatgatgtgccaatggtgctagttgggaacaagtgtgacctg cccacaagaacagtagacacaaaacaggctcaagagttagcaaagagctacggaatcccc ttcatagagacatctgctaaaaccagacagggtgtggaagatgctttttacacactagtg agagagatccggcagtatcgcatgaaaaagctcaacagcaatgaagatgggaaccaaggc tgtatgggattgtcctgcgttgtgatgtga

DBGET integrated database retrieval system