Cuculus canorus (common cuckoo): 104068467 Help Entry 104068467         CDS       T08597                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca03082   ATP-dependent chromatin remodeling cuca04217   Necroptosis Brite KEGG Orthology (KO) [BR:cuca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104068467  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104068467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cuca03036]     104068467   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cuca04147]     104068467 Chromosome and associated proteins [BR:cuca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104068467 Exosome [BR:cuca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104068467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104068467 NCBI-ProteinID:  XP_053932998 LinkDB All DBs Position 11:6160729..6163239 Genome browser AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQSSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcgggccggggcaagtccggcggcaaagcgcgggctaaagccaagtcgcgctcgtcg cgggccgggctgcagttccccgtggggcgggtgcaccggctgctgcgcaagggcaactac gcggagcgggtgggcgccggggcgcccgtgtacctggcggccgtgctggagtacctgtcg gctgagatcctcgagctggcgggcaacgcggcccgcgacaataagaagacgcgcatcatc ccgcggcacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctcggcggc gtgaccatcgcccagggcggtgtcctgcccaacatccaggccgtgctgctgcccaagaag acgcagagctccaagaagtga

DBGET integrated database retrieval system