Cuculus canorus (common cuckoo): 104068903 Help Entry 104068903         CDS       T08597                                  Symbol INS Name (RefSeq) LOW QUALITY PROTEIN: insulin   KO K04526   insulin Organism cuca  Cuculus canorus (common cuckoo) Pathway cuca04010   MAPK signaling pathway cuca04068   FoxO signaling pathway cuca04081   Hormone signaling cuca04114   Oocyte meiosis cuca04140   Autophagy - animal cuca04150   mTOR signaling pathway cuca04810   Regulation of actin cytoskeleton cuca04910   Insulin signaling pathway cuca04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cuca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104068903 (INS)    04068 FoxO signaling pathway     104068903 (INS)    04150 mTOR signaling pathway     104068903 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104068903 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104068903 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104068903 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104068903 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104068903 (INS)    04914 Progesterone-mediated oocyte maturation     104068903 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cuca04052]     104068903 (INS) Cytokines and neuropeptides [BR:cuca04052]  Neuropeptides   Unclassified    104068903 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  104068903 NCBI-ProteinID:  XP_009570140 UniProt:  A0A091FRU0 LinkDB All DBs Position 5:42047407..42052648 Genome browser AA seq 161 aa AA seqDB search MGTYATSYLLDADGSYKYGKERIGTLLPSKRSSSLXANFSPLLAASFWVSDCLTMALWIR SLPLLALLALSGPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQPLVSGP LHGEIGELPFQKEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggggacatatgcaacttcctacctcctagatgctgatggatcatataaatatggaaaa gagagaatagggacgttactaccaagcaaacggtcttcatctctctgagcaaacttctct ccacttcttgctgccagtttttgggtaagtgattgcctcaccatggctctctggatccga tcactgcctctcctggccctccttgccctttctggccctggaaccagccatgccgcagcc aaccagcacctctgtggctcccacttggtggaggctctctacctggtgtgtggagagcgg ggtttcttctactcccctaaagcccgacgggacattgagcagcctctagtgagcggtccc ttgcatggtgagataggagagctgcccttccagaaggaggagtttgagaaagtgaagcga gggatcgttgagcaatgctgccacaacacatgctccctctaccaactggaaaactactgc aactag

DBGET integrated database retrieval system