Cuculus canorus (common cuckoo): 128852684 Help Entry 128852684         CDS       T08597                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism cuca  Cuculus canorus (common cuckoo) Brite KEGG Orthology (KO) [BR:cuca00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cuca03037]     128852684 (BBIP1) Cilium and associated proteins [BR:cuca03037]  Primary cilia and associated proteins   BBSome    128852684 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  128852684 NCBI-ProteinID:  XP_053927441 LinkDB All DBs Position 7:6875076..6880188 Genome browser AA seq 71 aa AA seqDB search MPEGKAAFREVLPKQGQLSVEDAPAMVLCKPKVLPLKSVTLEKLEKLQRAALEALEAAEA APAEGAARSRP NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggaaggccgcgttccgggaggttctgcccaagcaagggcagctgtcggtg gaggacgctcccgccatggtgctgtgcaagccgaaggtgctgcccctcaagtcggtgacg ctggagaagctggagaagctgcagcgcgcggcgctggaggcgctggaagcggcggaggcg gcgccggccgagggggcagcgcggtcccggccctag

DBGET integrated database retrieval system