Cheilinus undulatus (humphead wrasse): 121506916 Help Entry 121506916         CDS       T07473                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04137   Mitophagy - animal cud04140   Autophagy - animal cud04144   Endocytosis cud04145   Phagosome cud04148   Efferocytosis cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121506916    04145 Phagosome     121506916    04140 Autophagy - animal     121506916    04137 Mitophagy - animal     121506916    04148 Efferocytosis     121506916  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121506916  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cud04131]     121506916   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121506916    04031 GTP-binding proteins [BR:cud04031]     121506916 Membrane trafficking [BR:cud04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     121506916 Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121506916   Exosomal proteins of other body fluids (saliva and urine)    121506916   Exosomal proteins of colorectal cancer cells    121506916   Exosomal proteins of bladder cancer cells    121506916 GTP-binding proteins [BR:cud04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     121506916 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin PduV-EutP NTPase_1 AAA_7 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 FLYWCH_N ATPase_2 NACHT NB-ARC AAA_14 SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  121506916 NCBI-ProteinID:  XP_041638895 LinkDB All DBs Position 3:28628115..28641607 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCLSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgcttttgaaagtcatcatcctgggagattctggtgttgga aagacctccctaatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcggacttcctgactaaggaggtgatggtggacgaccggcttgtgacgatgcag atctgggacactgctggccaggagaggtttcagtctctgggagttgcgttctaccgtgga gcagattgctgtgtgctggtgtttgatgtgactgcacccaacaccttcaagacgctcgac agctggagggatgagttcctgatccaggccagccctcgagatcctgagaacttccccttt gtggtgctaggcaacaagattgacctggagaacagacaggtaactaccaaaagggctcag gcttggtgtctgagtaagaataacatcccgtactttgagaccagtgccaaagaagctatc aatgtagaacaggcattccagacaattgcacgtaacgccctcaaacaggagacagaggtg gagttgtataatgaattcccagagcccataaaactggataggaacgacagagctaaacct tcagcagaaagctgcagctgctga

DBGET integrated database retrieval system