Cheilinus undulatus (humphead wrasse): 121508557 Help Entry 121508557         CDS       T07473                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud03030   DNA replication cud03410   Base excision repair cud03420   Nucleotide excision repair cud03430   Mismatch repair cud03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cud00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     121508557 (pold4)    03410 Base excision repair     121508557 (pold4)    03420 Nucleotide excision repair     121508557 (pold4)    03430 Mismatch repair     121508557 (pold4)    03440 Homologous recombination     121508557 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cud03032]     121508557 (pold4)    03400 DNA repair and recombination proteins [BR:cud03400]     121508557 (pold4) DNA replication proteins [BR:cud03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     121508557 (pold4) DNA repair and recombination proteins [BR:cud03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       121508557 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      121508557 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  121508557 NCBI-ProteinID:  XP_041641423 LinkDB All DBs Position 4:2902855..2910998 Genome browser AA seq 108 aa AA seqDB search MTTKHRLITDSFKVVKKARKGGKREKRSPSPPPQKENESKSVREEELQQLQQFDLDWRFG PCTGISRLQRWERAKLHGLNPPEEIRELLLQTQNDPEYNQSLWREYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaaacatcgactgataactgattcgttcaaggtggtgaaaaaagcaaggaag gggggcaaacgagagaagaggtctccgtctccgcctccacagaaagagaatgaatctaaa tcagtcagagaggaggagcttcagcagctgcaacagtttgatctggattggaggtttggg ccgtgcacaggtatcagccggctgcagagatgggagagagctaaacttcacggtctgaac cctcctgaggagatcagagagctgctgctgcagacacaaaacgaccccgagtacaaccag agcctgtggagggaatatcctttgtaa

DBGET integrated database retrieval system