Cheilinus undulatus (humphead wrasse): 121511066
Help
Entry
121511066 CDS
T07473
Symbol
got2b
Name
(RefSeq) glutamic-oxaloacetic transaminase 2b, mitochondrial
KO
K14455
aspartate aminotransferase, mitochondrial [EC:
2.6.1.1
]
Organism
cud
Cheilinus undulatus (humphead wrasse)
Pathway
cud00220
Arginine biosynthesis
cud00250
Alanine, aspartate and glutamate metabolism
cud00270
Cysteine and methionine metabolism
cud00330
Arginine and proline metabolism
cud00350
Tyrosine metabolism
cud00360
Phenylalanine metabolism
cud00400
Phenylalanine, tyrosine and tryptophan biosynthesis
cud01100
Metabolic pathways
cud01200
Carbon metabolism
cud01210
2-Oxocarboxylic acid metabolism
cud01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
cud00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
121511066 (got2b)
00270 Cysteine and methionine metabolism
121511066 (got2b)
00220 Arginine biosynthesis
121511066 (got2b)
00330 Arginine and proline metabolism
121511066 (got2b)
00350 Tyrosine metabolism
121511066 (got2b)
00360 Phenylalanine metabolism
121511066 (got2b)
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
121511066 (got2b)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
cud01007
]
121511066 (got2b)
Enzymes [BR:
cud01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
121511066 (got2b)
Amino acid related enzymes [BR:
cud01007
]
Aminotransferase (transaminase)
Class I
121511066 (got2b)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Motif
Other DBs
NCBI-GeneID:
121511066
NCBI-ProteinID:
XP_041645521
LinkDB
All DBs
Position
1:complement(33133759..33145649)
Genome browser
AA seq
428 aa
AA seq
DB search
MALRKSNKVILCLGNISPSLGILSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNL
GVGAYRDDQGKPFVLSCVRKAEAIIAAKQLDKEYLAIGGLGEFAKSCAQLALGSDNEVLK
SGRNITVQTISGTGSLRIGANFLARFHGGPRDVYLPKPSWGNHTPIFRDAGMQLNAYRYY
DASTCGFDFKGALDDISKIPEKSVILLHACAHNPTGVDPKPEQWKEISDIVKKRNLLPFF
DMAYQGFASGDIDRDAWAVRYFIEQGHNILLSQSFAKNMGLYGERVGGFTVVCGNAEEAK
RVESQLKILIRPIYSNPPMNGARIASTILNTPELYSLWLQEVHGMANRIIKMREQLVAGL
KKEGSSHNWQHVIDQIGMFCFTGLKPDQVERLTKEFSVYMTKDGRISMAGVSSGNVGYLA
QAIHAVTK
NT seq
1287 nt
NT seq
+upstream
nt +downstream
nt
atggccctgcgaaagtcaaacaaggtgatcctctgtttgggaaacatctccccatctctg
ggaatcctgtccacccggaacagctcatggtggggtggagtgcagatgggtccccccgat
cccatcctgggggtgactgaggccttcaagagagacaccaacccaaagaagatgaacctg
ggagtgggagcctacagggatgaccaaggcaagccctttgtgctcagctgtgtccgcaag
gcagaggccattattgcagccaagcagctggacaaggagtacctcgccatcgggggtctg
ggagaatttgccaagtcctgtgcccagcttgcccttggttctgataatgaggttctgaag
agtggcaggaacatcactgtccagaccatctcaggcactgggtctctgcgcattggagcc
aacttcttggctcgatttcatggaggtccacgcgatgtttacctgcccaaaccctcctgg
ggaaaccacacacccatcttcagagatgctggcatgcagctgaatgcatacagatactat
gacgcctccacctgtggcttcgacttcaaaggagcccttgacgacatttctaaaatccca
gagaagagcgtgatcctgctgcatgcctgtgctcacaaccccactggtgtggaccccaag
cctgagcagtggaaggagatttctgacattgtgaagaaaaggaatctgctcccgttcttc
gacatggcctatcagggcttcgccagtggagacattgaccgtgatgcctgggctgtgcgc
tacttcatcgagcagggtcacaacatcctgctgtcccagtcctttgcgaagaacatgggg
ctctatggtgagcgtgtcgggggcttcactgtggtgtgcggcaacgcagaagaggcaaag
agggtcgagtctcaactcaagatcctcatcagacccatttactcaaacccgcccatgaat
ggtgccagaattgcatcaaccattctcaacacaccagagctgtactcattgtggctgcag
gaggtccatggtatggctaaccgcatcataaagatgagagaacagctggtggctggtctg
aagaaggagggatcctcccacaactggcagcacgtcattgaccagattgggatgttctgt
ttcacaggactcaaacctgaccaggttgagcgccttacaaaggagttttcagtgtacatg
accaaggatggcagaatttccatggcaggtgtttcctctgggaacgttggctacctggca
caagcgatccacgctgtcaccaagtag
DBGET
integrated database retrieval system