Cheilinus undulatus (humphead wrasse): 121513805 Help Entry 121513805         CDS       T07473                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04010   MAPK signaling pathway cud04144   Endocytosis cud04370   VEGF signaling pathway cud04510   Focal adhesion cud04520   Adherens junction cud04530   Tight junction cud04810   Regulation of actin cytoskeleton cud04912   GnRH signaling pathway cud05100   Bacterial invasion of epithelial cells cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121513805 (cdc42l)    04370 VEGF signaling pathway     121513805 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121513805 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121513805 (cdc42l)    04520 Adherens junction     121513805 (cdc42l)    04530 Tight junction     121513805 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121513805 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     121513805 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121513805 (cdc42l)    05100 Bacterial invasion of epithelial cells     121513805 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cud04131]     121513805 (cdc42l)    03036 Chromosome and associated proteins [BR:cud03036]     121513805 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121513805 (cdc42l)    04031 GTP-binding proteins [BR:cud04031]     121513805 (cdc42l) Membrane trafficking [BR:cud04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121513805 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     121513805 (cdc42l)   Macropinocytosis    Ras GTPases     121513805 (cdc42l) Chromosome and associated proteins [BR:cud03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121513805 (cdc42l) Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of microglial cells    121513805 (cdc42l)   Exosomal proteins of breast milk    121513805 (cdc42l) GTP-binding proteins [BR:cud04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121513805 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  121513805 NCBI-ProteinID:  XP_041649714 LinkDB All DBs Position 8:complement(32773526..32778592) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPRVPYLLVGTQVDLR EDSNTIDKLAKNKQRPLMHESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtggtggtcggggatggtgcagtaggaaagacctgcttgctg atctcctacacaaccaacaagttcccctcagaatatgtaccaacggtttttgacaattat gcagtaacagtgatgattggaggagagccctacacactgggactatttgacacagccggt caggaggattacgacaggctgcgtcctctcagttatccacagacagatgtgttcctcgta tgtttctctgtcgtgtctccctcatcatttgaaaatgtcaaagagaagtgggttcctgag ataactcaccactgcccacgcgtaccttacctcttggtgggcactcaggtggatctgagg gaagactccaacacaattgacaagctggcaaagaacaaacagcgtcccctaatgcatgag agcggagagaagctggcccgtgagctcagggctgtcaaatacgtggagtgctctgctttg acacagcgagggctgaagaacgtgtttgatgaggccatcctggctgccttggaacctccc gagactaaaaccaagagaaagtgtgtgctgctatag

DBGET integrated database retrieval system