Cheilinus undulatus (humphead wrasse): 121514860 Help Entry 121514860         CDS       T07473                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud03082   ATP-dependent chromatin remodeling cud04217   Necroptosis Brite KEGG Orthology (KO) [BR:cud00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121514860  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121514860  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cud03036]     121514860   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121514860 Chromosome and associated proteins [BR:cud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121514860 Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121514860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121514860 NCBI-ProteinID:  XP_041651176 LinkDB All DBs Position 9:44141067..44142108 Genome browser AA seq 125 aa AA seqDB search MIALKINMSGSGRSGKTRAAAKSRSSRAGLKFPVGRVHRLLRKGKYSKRVGAGASVYLAA VLEYLTSEVMELAGNMARDSGKRRIIPRYLQLSVCIDPELNKLLRRVTIPEGGVVPYLNP ALWPK NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgattgcattgaaaataaacatgtcaggaagcggtagaagcgggaagacgagagccgca gcaaagagccgctcctcccgtgctgggctgaagttccctgtcggtcgtgtccacaggctg ctccgtaagggaaagtattccaagcgtgtgggagccggagccagtgtgtacctggcggct gtgctggagtacctgacttctgaggtgatggagctggctggtaacatggcccgtgacagc gggaagagacgtatcatcccccgatacctacagctgtctgtctgcattgacccggagctc aacaagttactgagacgagtgaccatccccgagggcggcgtggtgccctatctaaatcct gctctgtggccaaagtga

DBGET integrated database retrieval system