Cheilinus undulatus (humphead wrasse): 121515258 Help Entry 121515258         CDS       T07473                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud03410   Base excision repair cud04140   Autophagy - animal cud04217   Necroptosis Brite KEGG Orthology (KO) [BR:cud00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     121515258 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121515258 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     121515258 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cud03036]     121515258 (hmgb1b)    03400 DNA repair and recombination proteins [BR:cud03400]     121515258 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121515258 (hmgb1b) Chromosome and associated proteins [BR:cud03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     121515258 (hmgb1b) DNA repair and recombination proteins [BR:cud03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      121515258 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      121515258 (hmgb1b) Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121515258 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Ribosomal_60s Ets Motif Other DBs NCBI-GeneID:  121515258 NCBI-ProteinID:  XP_041651870 LinkDB All DBs Position 2:complement(40530847..40533471) Genome browser AA seq 200 aa AA seqDB search MVKDPNKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFE DMAKQDKVRYEREMKNYIPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKVKGENPGLS IGDTAKKLGQMWNDSSSEERQPYEKKASKLKEKYDKDIVAYRTKGKVDSAPAAAAEDDDE DEEEEEGEEEEEEDDEEDDE NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggtgaaagatccaaataagccgcggggcaagatgtcctcatatgcctactttgtgcag acatgcagagaggagcataagaagaagcatccggatgcctctgtcaacttttcagagttc tccaagaaatgctcagagagatggaagaccatgtcaccgaaagagaagggcaagtttgaa gacatggccaaacaagataaggttcgttatgagagggaaatgaagaattacattcccccc aagggccagaagaagaagcgattcaaggaccccaacgcccccaagagaccaccgtctgca ttcttccttttctgtgccgactttcgccccaaagtaaaaggtgagaaccctgggctctcc attggagacacagcaaagaagttgggacagatgtggaatgactcatcctcagaggaaagg cagccttatgagaagaaggcatccaagttgaaggagaagtacgacaaggatattgttgct taccgcacaaagggcaaagtggattctgcaccagctgctgcagcagaagatgacgatgag gacgaagaagaggaggagggagaggaggaggaggaagaagacgacgaagaggatgatgag tag

DBGET integrated database retrieval system