Cheilinus undulatus (humphead wrasse): 121515288 Help Entry 121515288         CDS       T07473                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud03082   ATP-dependent chromatin remodeling cud04217   Necroptosis Brite KEGG Orthology (KO) [BR:cud00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     121515288  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121515288  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cud03036]     121515288   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121515288 Chromosome and associated proteins [BR:cud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121515288 Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121515288 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  121515288 NCBI-ProteinID:  XP_041651914 LinkDB All DBs Position 9:41843217..41843606 Genome browser AA seq 127 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAAKK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgaggcaagacaggcggaaaggccagagccaaggcaaagacccgctcctcc cgtgccgggctccagttccccgtcggtcgtgtccacagactgctccgcaaaggaaactat gctgagcgtgtgggagccggagcccccgtctacctggcggctgtgctcgagtacctgacc gctgagatcctggagttggctggaaacgctgcccgggacaacaagaagaccaggatcatc ccccgtcacctgcagctggctgtccgcaacgacgaggagctcaacaagctgctgggagga gtcaccatcgctcagggcggcgtgctgcccaacatccaggctgttctgctgcccaagaag accgagaaggccgccaagaagtag

DBGET integrated database retrieval system