Cheilinus undulatus (humphead wrasse): 121516415 Help Entry 121516415         CDS       T07473                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04080   Neuroactive ligand-receptor interaction cud04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     121516415 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121516415 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cud04052]     121516415 (apln) Cytokines and neuropeptides [BR:cud04052]  Neuropeptides   GPCR binding    121516415 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  121516415 NCBI-ProteinID:  XP_041653637 LinkDB All DBs Position 10:complement(6691084..6722126) Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLLVSLLCSASAGPMASTEHGRELEDAPTMRKMVQQNPARGGQTHRPAGW KRRRPRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc agtgctggtcccatggcctccacggagcatggcagagagctggaagatgcgcctacgatg agaaaaatggtccagcaaaaccctgcaaggggcggtcagacccacagaccagccggctgg aagaggagacgcccacgaccacgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system