Cheilinus undulatus (humphead wrasse): 121518608 Help Entry 121518608         CDS       T07473                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04145   Phagocytosis cud04517   IgSF CAM signaling cud04814   Motor proteins cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121518608 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     121518608 (dynll2b)   09142 Cell motility    04814 Motor proteins     121518608 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121518608 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cud03037]     121518608 (dynll2b)    04812 Cytoskeleton proteins [BR:cud04812]     121518608 (dynll2b) Cilium and associated proteins [BR:cud03037]  Motile cilia and associated proteins   Dynein arm    121518608 (dynll2b) Cytoskeleton proteins [BR:cud04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      121518608 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Motif Other DBs NCBI-GeneID:  121518608 NCBI-ProteinID:  XP_041656966 LinkDB All DBs AA seq 89 aa AA seqDB search MSDKKAVIKNADMPDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggcggtgataaagaatgctgacatgcctgatgaaatgcagcaggat gcagtggactgtgcaatgcaggccatggagaaatacaacattgagaaggatattgctgcc tatgtcaaaaaggagtttgacaagaagtataaccccacatggcattgcattgttgggagg aattttggcagctatgtgacacacgagacaaagcatttcatctacttctacctgggtcaa gtagccattctactcttcaagtcaggctga

DBGET integrated database retrieval system