Cheilinus undulatus (humphead wrasse): 121519113 Help Entry 121519113         CDS       T07473                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04010   MAPK signaling pathway cud04068   FoxO signaling pathway cud04081   Hormone signaling cud04114   Oocyte meiosis cud04140   Autophagy - animal cud04150   mTOR signaling pathway cud04810   Regulation of actin cytoskeleton cud04910   Insulin signaling pathway cud04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     121519113 (ins)    04150 mTOR signaling pathway     121519113 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     121519113 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121519113 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cud04052]     121519113 (ins) Cytokines and neuropeptides [BR:cud04052]  Neuropeptides   Unclassified    121519113 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  121519113 NCBI-ProteinID:  XP_041657839 LinkDB All DBs Position 12:49478665..49479207 Genome browser AA seq 120 aa AA seqDB search MAALWLQSVSLLVLLVVSWPGTQAAAPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVEPF KGFLPPKADGAATAGENEVAEFAFKDLAFKDQMEMMVKRGIVEQCCHRPCNLFDLQNYCN NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcagctctgtggctccagtccgtgtctctgctggtcttactggtcgtgtcgtggccc ggcactcaggccgccgcccctcctcagcacctgtgcggctctcacctggtggacgccctc tacctggtgtgtggggaccgaggcttcttctacaaccccaagagagacgtggagcccttc aagggtttcctccctccgaaggcggacggagcagcgacagcgggtgagaacgaggtggca gagttcgcctttaaggacctggccttcaaggatcagatggagatgatggtgaagcgtggc atcgtggagcagtgctgccacagaccctgcaacctcttcgacctgcagaactactgcaac tag

DBGET integrated database retrieval system