Cheilinus undulatus (humphead wrasse): 121524545 Help Entry 121524545         CDS       T07473                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04382   Cornified envelope formation cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121524545 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121524545 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121524545 (s100a10a) Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of microglial cells    121524545 (s100a10a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_FSTL1 SPARC_Ca_bdg EH WHD_MCM4 DUF8157 Bcl-2 NNH2 EF-hand_STIM1 DEK_C Motif Other DBs NCBI-GeneID:  121524545 NCBI-ProteinID:  XP_041665919 LinkDB All DBs Position LG16 Genome browser AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASKEGRSGTLSRRELRELMENELSNFLKSQKDPAAVDQIMK DLDTNGDGQVDFEEFVSLVVGLSVACEQCYQMHMKKMAKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactagagacagctatggagtcccttatcaaggtgttccacagatacgcc tctaaagaagggcgcagcggcactctgagccgacgagagctcagagagctgatggaaaat gagctgtcaaacttcctcaagtctcagaaggaccctgctgctgtggaccaaatcatgaag gacctggacacaaacggggatggccaggtggactttgaagagtttgtttctctggttgtt ggactttccgttgcctgtgagcagtgctatcagatgcatatgaagaaaatggcaaagaag tga

DBGET integrated database retrieval system