Cheilinus undulatus (humphead wrasse): 121525933 Help Entry 121525933         CDS       T07473                                  Symbol arf6b Name (RefSeq) ADP-ribosylation factor 6b   KO K07941   ADP-ribosylation factor 6 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04144   Endocytosis cud04517   IgSF CAM signaling cud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121525933 (arf6b)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121525933 (arf6b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121525933 (arf6b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cud04131]     121525933 (arf6b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121525933 (arf6b)    04031 GTP-binding proteins [BR:cud04031]     121525933 (arf6b) Membrane trafficking [BR:cud04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121525933 (arf6b)   Arf GTPases and associated proteins    Arf GTPases     121525933 (arf6b) Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121525933 (arf6b)   Exosomal proteins of colorectal cancer cells    121525933 (arf6b) GTP-binding proteins [BR:cud04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     121525933 (arf6b) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  121525933 NCBI-ProteinID:  XP_041668088 LinkDB All DBs Position LG18 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaagtgctctcaaagattttcgggaacaaggagatgagaatattgatgcttgga cttgatgctgctggaaagacaacaatcctttacaaactgaaacttggacagtctgtcacc acaatcccaacagtcggcttcaatgtggagacagtcacctacaaaaatgtcaagttcaac gtctgggatgttggaggccaagacaagatccgtcctctgtggcgacactactacacaggc acccaagggttgattttcgtggtggattgtgctgacagggatcgcatcgatgaggccagg caggaactccaccgcatcatcaacgaccgggagatgagggatgccatcatcttgatattt gccaataagcaagacctcccggacgccatgaagccgcacgaaatccaagagaagctcgga ttgacccgcatcagagataggaattggtatgttcagccctcctgtgcgacctcaggtgat ggactgtatgagggcttgacatggctaacctcaaattacaaatcttaa

DBGET integrated database retrieval system