Cheilinus undulatus (humphead wrasse): 121527916 Help Entry 121527916         CDS       T07473                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cud00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121527916  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cud04121]     121527916    03400 DNA repair and recombination proteins [BR:cud03400]     121527916 Ubiquitin system [BR:cud04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      121527916    Cul5 complex      121527916 DNA repair and recombination proteins [BR:cud03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121527916 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  121527916 NCBI-ProteinID:  XP_041670891 LinkDB All DBs Position LG20 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagactacaatcttcacagacgccaaagag tccaccacagtgtatgagctgaagcgcattgttgaaggaatccttaagagaacgcctgaa gaccagaggctctacaaagatgaccagctgctagaggacagcaaaacccttggtgattgt ggattcactaaccagactgccagacctcaggccccagctacagttggtctggctttccgc ataaatgacgagatgttcgaacagcttcacattgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactcgggtagcactgctaatgagcaggccgtgcagtga

DBGET integrated database retrieval system