Cheilinus undulatus (humphead wrasse): 121529641 Help Entry 121529641         CDS       T07473                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud04010   MAPK signaling pathway cud04137   Mitophagy - animal cud04140   Autophagy - animal cud04218   Cellular senescence cud04371   Apelin signaling pathway cud04519   Cadherin signaling cud04625   C-type lectin receptor signaling pathway cud04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:cud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121529641 (rras)    04371 Apelin signaling pathway     121529641 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     121529641 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121529641 (rras)    04137 Mitophagy - animal     121529641 (rras)   09143 Cell growth and death    04218 Cellular senescence     121529641 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121529641 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121529641 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cud04147]     121529641 (rras)    04031 GTP-binding proteins [BR:cud04031]     121529641 (rras) Exosome [BR:cud04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121529641 (rras)   Exosomal proteins of bladder cancer cells    121529641 (rras) GTP-binding proteins [BR:cud04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121529641 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF192 Motif Other DBs NCBI-GeneID:  121529641 NCBI-ProteinID:  XP_041673531 LinkDB All DBs Position LG21 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KSDLETQRVISREDAQAFASENRIHYMEASAKNRYNVDEAFIELVQIIRRFQEVEAPPPP SHHPGKQKGGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgccgaggaggagagattcaaactggtggtggtgggaggagggggggtgggcaag agcgcgctcaccatccagttcatccagtcttacttcgtctcggactatgaccccaccatt gaggactcgtacactaagatctgcaccgtggatgggaaagagaccagactggacatcttg gacaccgctggtcaggaggagtttggagccatgagggagcagtacatgagatctggagaa ggattcttattagtgtttgctctcaacgaccgcggcagctaccatgaagtccagaagttc cacacgcagatcctgagggtgaaggacagagatgacttccccatggttctggtgggaaac aagtccgacctggagacccagagagtgatctccagagaggacgctcaggcatttgcctca gagaacaggatccactacatggaggcttcggccaagaacaggtacaacgtggacgaggcc ttcatagagctggtccagatcatcaggcggttccaggaggttgaagctccgccccctccg tctcatcaccccgggaaacagaaaggagggggttgtccttgtgtcctcctgtga

DBGET integrated database retrieval system