Cheilinus undulatus (humphead wrasse): 8774887 Help Entry 8774887           CDS       T07473                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cud  Cheilinus undulatus (humphead wrasse) Pathway cud00190   Oxidative phosphorylation cud01100   Metabolic pathways Module cud_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cud00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     8774887 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cud03029]     8774887 (ND4L) Enzymes [BR:cud01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      8774887 (ND4L) Mitochondrial biogenesis [BR:cud03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     8774887 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  8774887 NCBI-ProteinID:  YP_003434317 UniProt:  D2Y3E1 LinkDB All DBs Position MT:10101..10396 Genome browser AA seq 98 aa AA seqDB search MTPVQFAFSSAFLLGLTGLTFHRTHLLSALLCLEGMMLSLFIALSLWALQLNSASFSAAP MLLLAFSACEASAGLALLVATARTHGTDRLKNLNLLQC NT seq 296 nt NT seq  +upstreamnt  +downstreamnt atgacccctgtccaattcgcattctcctcagcatttctcctaggactcactggcttaacc ttccaccgaacccacctcctctcagcccttctctgcttagaaggaataatactatcccta tttatcgccctctcattatgagcacttcaattaaactcagctagcttctctgccgcaccc atactcctcttagctttttcagcttgtgaggcaagcgcaggactagccctcctagtagcc accgctcggacgcatggcacagaccgtctaaaaaaccttaacctcctacaatgcta

DBGET integrated database retrieval system