Cupriavidus necator NH9: BJN34_21305 Help Entry BJN34_21305       CDS       T05121                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cuh  Cupriavidus necator NH9 Pathway cuh02024   Quorum sensing cuh03018   RNA degradation Brite KEGG Orthology (KO) [BR:cuh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BJN34_21305  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BJN34_21305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cuh03019]     BJN34_21305    03036 Chromosome and associated proteins [BR:cuh03036]     BJN34_21305 Messenger RNA biogenesis [BR:cuh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BJN34_21305 Chromosome and associated proteins [BR:cuh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BJN34_21305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AQV96409 UniProt:  A0A1U9UV15 LinkDB All DBs Position 2:287871..288185 Genome browser AA seq 104 aa AA seqDB search MQPKQSLQQNDFLNSVRKERKRVDVYLVNGVRLTGSIASFDQFVVMLSSPGGGMQTIYKS AISTIQVQTAARQAGSSTANDRESTTPSIVERKRRPITTGSGGE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcctaagcaatcccttcagcaaaacgactttctgaactcagtgcgcaaggagcgg aagcgggtcgacgtgtacctcgtcaatggcgtcaggctcactggttcaatcgcgtcgttc gaccagttcgtggtgatgctgagttcgcccggcggcggcatgcagacgatttacaagagc gccatatcgaccattcaagtgcagacagcggcgcgtcaagctggttccagcacggccaat gacagggagtccacgacgccttctattgtcgagcggaaacgtcggccgataacaactggt agcggaggcgaatag

DBGET integrated database retrieval system